Java tutorial
/* * Copyright 2010 the original author or authors. * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. */ package uk.ac.ebi.interpro.scan.model; import org.apache.commons.lang.SerializationUtils; import org.apache.log4j.Logger; import org.junit.Ignore; import org.junit.Test; import org.junit.runner.RunWith; import org.springframework.test.context.ContextConfiguration; import org.springframework.test.context.junit4.SpringJUnit4ClassRunner; import org.xml.sax.SAXException; import java.io.IOException; import java.text.ParseException; import java.util.HashSet; import java.util.Set; import static org.junit.Assert.assertEquals; /** * Test cases for {@link ProteinMatchesHolder} * * @author Antony Quinn * @version $Id$ */ @RunWith(SpringJUnit4ClassRunner.class) @ContextConfiguration public class ProteinMatchesHolderTest extends AbstractTest<ProteinMatchesHolder> { private static final Logger LOGGER = Logger.getLogger(ProteinMatchesHolderTest.class.getName()); @Test public void testEquals() throws IOException, ParseException { // Original ProteinMatchesHolder original = getPfamObject(); // Copy ProteinMatchesHolder copy = (ProteinMatchesHolder) SerializationUtils.clone(original); // Should be equal assertEquals("Original and copy should be equal", original, copy); // Print if (LOGGER.isDebugEnabled()) { LOGGER.debug(original); LOGGER.debug(super.marshal(original)); } } // TODO: Fix UnsupportedOperationException -- the @Ignore annotation was added in June 2011 (http://tinyurl.com/6tq8nz4), yet the comment is not correct -- the SignatureLibraryRelease element does *not* cause the exception @Test @Ignore("Round trip does not work. The embedded SignatureLibraryRelease element is not parsed.") public void testXml() throws IOException, SAXException { super.testSupportsMarshalling(ProteinMatchesHolder.class); super.testXmlRoundTrip(); } private ProteinMatchesHolder getPfamObject() { // Create protein Protein p = new Protein("MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDI"); Signature signature = new Signature("PF02310", "B12-binding"); p.addCrossReference(new ProteinXref("A0A000_9ACTO")); Set<Hmmer3Match.Hmmer3Location> locations = new HashSet<Hmmer3Match.Hmmer3Location>(); locations.add(new Hmmer3Match.Hmmer3Location(3, 107, 3.0, 3.7e-9, 1, 104, 121, 2, 108)); p.addMatch(new Hmmer3Match(signature, 0.035, 3.7e-9, locations)); // Create release SignatureLibraryRelease release = new SignatureLibraryRelease(SignatureLibrary.PFAM, "23"); signature.setSignatureLibraryRelease(release); // Create holder ProteinMatchesHolder holder = new ProteinMatchesHolder(); holder.addProtein(p); return holder; } }